Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Selectivity interaction (KinomeScan (DiscoverX)) EUB0000753a ACVR2A
Assay data:1 Tested
SummaryRelated BioAssays by Target
ACVR2A DiscoveRx kinase panel
KinomeScan assay: inhibition of ACVR2A
Assay data:1 Active, 108 Tested
SummaryCompounds, ActiveRelated BioAssays by Target
ACtR2(AC2ALGE1) Takeda global kinase panel
Assay data:1 Activity ≤ 1 µM, 1 Tested
SummaryCompounds, activity ≤ 1 µMRelated BioAssays by Target
ACVR2A Invitrogen Lab (UK) kinase screen (BI)
Inhibition of ACVR2A (unknown origin) assessed as residual activity measured at 1 uM
Assay data:3 Tested
Inhibition of ACVR2A (unknown origin) assessed as residual activity at 1 uM
Inhibition of human ACVR2A assessed as percent of control at 2000 nM by KINOMEscan assay relative to control
Inhibition of DNA-tagged human ACVR2A assessed as percent of control at 50000 nM by qPCR analysis relative to control
Inhibition of human ACVR2A assessed as percent of control at 1000 nM by KINOMEscan assay relative to control
Inhibition of human partial length ACVR2A (V171 to T499 residues) expressed in bacterial system assessed as residual activity at 10 uM by kinome scan method relative to control
SummaryPubMed CitationRelated BioAssays by Target
Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20 min
Assay data:27 Active, 9 Activity ≤ 1 µM, 29 Tested
SummaryCompounds, ActiveCompounds, activity ≤ 1 µMPubMed CitationRelated BioAssays by Target
Inhibition of human ACVR2A expressed in baculovirus expression system
Assay data:1 Active, 1 Tested
SummaryCompounds, ActivePubMed CitationRelated BioAssays by Target
Binding affinity to partial length human ACVR2A expressed in bacterial system at 1 uM by KINOMEscan assay
Binding affinity to wild-type human ACVR2A (V171 to T499 residues) expressed in bacterial expression system assessed as residual binding level at 10 uM by Kinomescan method relative to control
Inhibition of wild-type human ACVR2A (V171 to T499 residues) expressed in bacterial expression system at 1 uM by Kinomescan method relative to control
Inhibition of wild-type human ACVR2A (V171 to T499 residues) expressed in bacterial expression system at 10 uM by Kinomescan method relative to control
Filters: Manage Filters
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on