Conserved Protein Domain Family
Dynein_IC2
?
pfam11540: Dynein_IC2 (this model, PSSM-Id:402922 is obsolete and has been replaced by 463291)
Cytoplasmic dynein 1 intermediate chain 2
Intermediate chain IC 2 forms part of the complex cytoplasmic dynein 1 along with a heavy chain (HC), two light intermediate chains (LICs) and three light chains (LCs). The complex is responsible for hydrolysing ATP to generate force toward the minus end of microtubules. IC binds to the HC via the N terminal binding domain on the HC and ICs contain binding sites for the LCs. The ICs are responsible for binding to kinetochores and the Golgi apparatus through an interaction with the p150Glued subunit of dynactin which is another complex.
Links
?
Statistics
?
PSSM-Id: 402922
Aligned: 20 rows
Threshold Bit Score: 49.464
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Download Cn3D
PubMed ReferencesClick to see Conserved Features Help
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection: 
XP_004359310 101 KPTLSIQNlVIEFDIPPREIPTYTKATQTP 130 Cavenderia fasciculata
P54703        98 RPTLTIQSlVIEHDFPPKEIPMYSKGTQTM 127 Dictyostelium discoideum
EEN62938     108 SLKLSLTD-TSVINIPPREKVAYSKETQTI 136 Florida lancelet
CCD82454      99 RKRLGFSQ-INEINVPPKENISYSKITQTF 127 Schistosoma mansoni
XP_015794556 103 PISLALVN-VNEINIPPKESVTYNKQTQTT 131 two-spotted spider mite
ETN64513     103 PVNLCLVS-VQATNIPPKETVSYSKQTQTN 131 Anopheles darlingi
EFX81426      50 KPQLTKVS-VQATDIPPKETVTYAKQTQTV 78  common water flea
XP_975764    107 APNLSVVQ-VQSTNIPPKETVLYTKQTQTT 135 red flour beetle
XP_012550157 108 PQELQVVF-VQSTDIPPKETVIYTKQTQTT 136 domestic silkworm
XP_031358144 107 TPQLSVVA-VQSTSIPPKETVSYTKQTQTt 135 common eastern firefly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap