NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS17014.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
17014.1 Public Mus musculus 2 Pkig 23 108 98 CCDS HistoryNCBI Gene:18769Re-query CCDS DB by CCDS ID:17014.1Re-query CCDS DB by GeneID:18769See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 17014.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000064703.12 ENSMUSP00000068344.6 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000064703.12Link to Ensembl Protein Viewer:ENSMUSP00000068344.6Re-query CCDS DB by Nucleotide ID:ENSMUST00000064703Re-query CCDS DB by Protein ID:ENSMUSP00000068344
Original member Current member EBI ENSMUST00000099105.8 ENSMUSP00000096704.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000099105.8Link to Ensembl Protein Viewer:ENSMUSP00000096704.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000099105Re-query CCDS DB by Protein ID:ENSMUSP00000096704
Original member Current member EBI ENSMUST00000109400.2 ENSMUSP00000105027.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000109400.2Link to Ensembl Protein Viewer:ENSMUSP00000105027.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000109400Re-query CCDS DB by Protein ID:ENSMUSP00000105027
Original member Current member EBI ENSMUST00000126182.7 ENSMUSP00000120145.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000126182.7Link to Ensembl Protein Viewer:ENSMUSP00000120145.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000126182Re-query CCDS DB by Protein ID:ENSMUSP00000120145
Original member Current member EBI ENSMUST00000164399.7 ENSMUSP00000126223.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000164399.7Link to Ensembl Protein Viewer:ENSMUSP00000126223.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000164399Re-query CCDS DB by Protein ID:ENSMUSP00000126223
Original member NCBI NM_001039390.2 NP_001034479.1 Updated not alive Link to Nucleotide Sequence:NM_001039390.2Link to Protein Sequence:NP_001034479.1Re-query CCDS DB by Nucleotide ID:NM_001039390Re-query CCDS DB by Protein ID:NP_001034479
Current member NCBI NM_001039390.3 NP_001034479.1 Accepted alive Link to Nucleotide Sequence:NM_001039390.3Link to Protein Sequence:NP_001034479.1Re-query CCDS DB by Nucleotide ID:NM_001039390Re-query CCDS DB by Protein ID:NP_001034479Link to BLAST:NP_001034479.1
Original member Current member NCBI NM_001039391.2 NP_001034480.1 Accepted alive Link to Nucleotide Sequence:NM_001039391.2Link to Protein Sequence:NP_001034480.1Re-query CCDS DB by Nucleotide ID:NM_001039391Re-query CCDS DB by Protein ID:NP_001034480Link to BLAST:NP_001034480.1
Original member NCBI NM_001164053.1 NP_001157525.1 Updated not alive Link to Nucleotide Sequence:NM_001164053.1Link to Protein Sequence:NP_001157525.1Re-query CCDS DB by Nucleotide ID:NM_001164053Re-query CCDS DB by Protein ID:NP_001157525
Current member NCBI NM_001164053.2 NP_001157525.1 Accepted alive Link to Nucleotide Sequence:NM_001164053.2Link to Protein Sequence:NP_001157525.1Re-query CCDS DB by Nucleotide ID:NM_001164053Re-query CCDS DB by Protein ID:NP_001157525Link to BLAST:NP_001157525.1
Original member Current member NCBI NM_001164055.1 NP_001157527.1 Accepted alive Link to Nucleotide Sequence:NM_001164055.1Link to Protein Sequence:NP_001157527.1Re-query CCDS DB by Nucleotide ID:NM_001164055Re-query CCDS DB by Protein ID:NP_001157527Link to BLAST:NP_001157527.1
Original member NCBI NM_011106.2 NP_035236.1 Updated not alive Link to Nucleotide Sequence:NM_011106.2Link to Protein Sequence:NP_035236.1Re-query CCDS DB by Nucleotide ID:NM_011106Re-query CCDS DB by Protein ID:NP_035236
Current member NCBI NM_011106.3 NP_035236.1 Accepted alive Link to Nucleotide Sequence:NM_011106.3Link to Protein Sequence:NP_035236.1Re-query CCDS DB by Nucleotide ID:NM_011106Re-query CCDS DB by Protein ID:NP_035236Link to BLAST:NP_035236.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001034479.1 76 O70139 76 100% 0 0
NP_001034480.1 76 O70139 76 100% 0 0
NP_001157525.1 76 O70139 76 100% 0 0
NP_001157527.1 76 O70139 76 100% 0 0
NP_035236.1 76 O70139 76 100% 0 0

Chromosomal Locations for CCDS 17014.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 163721151 163721301 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 163725457 163725536 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (231 nt):
ATGATGGAAGTCGAGTCCTCCTACTCGGACTTCATCTCCTGCGACCGGACAGGCCGTCGGAATGCAGTCC
CTGACATCCAGGGTGACTCGGAGGCCGTGAGTGTGCGGAAGCTCGCTGGAGACATGGGCGAGCTCGCACT
TGAGGGAGCAGAAGGACAGGCAGAGGGAAGTACCCCCGACAAGGAAGCCAGCAGCCAGCCTGAGAGCAGT
GATGCGAACACCTCATCCTGA

Translation (76 aa):
MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGELALEGAEGQAEGSTPDKEASSQPESS
DANTSS


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH