NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS17841.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
17841.1 Public Mus musculus 3 Rpl34 23 108 98 CCDS HistoryNCBI Gene:68436Re-query CCDS DB by CCDS ID:17841.1See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 17841.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000079085.10 ENSMUSP00000078092.6 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000079085.10Link to Ensembl Protein Viewer:ENSMUSP00000078092.6Re-query CCDS DB by Nucleotide ID:ENSMUST00000079085Re-query CCDS DB by Protein ID:ENSMUSP00000078092
Original member Current member EBI ENSMUST00000062601.13 ENSMUSP00000086614.4 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000062601.13Link to Ensembl Protein Viewer:ENSMUSP00000086614.4Re-query CCDS DB by Nucleotide ID:ENSMUST00000062601Re-query CCDS DB by Protein ID:ENSMUSP00000086614
Original member NCBI NM_001005859.3 NP_001005859.1 Updated not alive Link to Nucleotide Sequence:NM_001005859.3Link to Protein Sequence:NP_001005859.1Re-query CCDS DB by Nucleotide ID:NM_001005859Re-query CCDS DB by Protein ID:NP_001005859
Current member NCBI NM_001005859.4 NP_001005859.1 Accepted alive Link to Nucleotide Sequence:NM_001005859.4Link to Protein Sequence:NP_001005859.1Re-query CCDS DB by Nucleotide ID:NM_001005859Re-query CCDS DB by Protein ID:NP_001005859Link to BLAST:NP_001005859.1
Original member NCBI NM_001287581.1 NP_001274510.1 Updated not alive Link to Nucleotide Sequence:NM_001287581.1Link to Protein Sequence:NP_001274510.1Re-query CCDS DB by Nucleotide ID:NM_001287581Re-query CCDS DB by Protein ID:NP_001274510
Current member NCBI NM_001287581.2 NP_001274510.1 Accepted alive Link to Nucleotide Sequence:NM_001287581.2Link to Protein Sequence:NP_001274510.1Re-query CCDS DB by Nucleotide ID:NM_001287581Re-query CCDS DB by Protein ID:NP_001274510Link to BLAST:NP_001274510.1
Original member NCBI NM_026724.2 NP_081000.1 Updated not alive Link to Nucleotide Sequence:NM_026724.2Link to Protein Sequence:NP_081000.1Re-query CCDS DB by Nucleotide ID:NM_026724Re-query CCDS DB by Protein ID:NP_081000
Current member NCBI NM_026724.3 NP_081000.1 Accepted alive Link to Nucleotide Sequence:NM_026724.3Link to Protein Sequence:NP_081000.1Re-query CCDS DB by Nucleotide ID:NM_026724Re-query CCDS DB by Protein ID:NP_081000Link to BLAST:NP_081000.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001005859.1 117 Q9D1R9 117 100% 0 0
NP_001274510.1 117 Q9D1R9 117 100% 0 0
NP_081000.1 117 Q9D1R9 117 100% 0 0

Chromosomal Locations for CCDS 17841.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 130726875 130726959 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 130728748 130728851 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 130729051 130729150 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 130729229 130729293 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (354 nt):
ATGGTCCAGCGTTTGACATACCGCCGTAGGCTTTCCTACAACACAGCCTCTAACAAAACTAGGCTGTCTC
GAACCCCTGGCAACAGGATTGTTTACCTCTACACCAAGAAGGTTGGGAAAGCACCTAAATCTGCATGTGG
CGTGTGCCCAGGCAGACTTCGAGGGGTTCGTGCTGTGCGGCCCAAAGTCCTTATGAGACTGTCTAAGACA
CAGAAGCACGTCAGCAGGGCCTATGGCGGCTCCATGTGTGCCAAGTGTGTCCGTGACAGGATCAAGCGGG
CTTTCCTTATTGAGGAGCAGAAAATCGTTGTGAAAGTCTTGAAGGCACAAGCACAGAGTCAGAAAGCAAA
ATAG

Translation (117 aa):
MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKT
QKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKAQAQSQKAK


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH