NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS37859.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
37859.1 Public Mus musculus 18 BC031181 23 108 98 CCDS HistoryNCBI Gene:407819Re-query CCDS DB by CCDS ID:37859.1Re-query CCDS DB by GeneID:407819See the combined annotation on chromosome 18 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 37859.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000040284.5 ENSMUSP00000040450.4 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000040284.5Link to Ensembl Protein Viewer:ENSMUSP00000040450.4Re-query CCDS DB by Nucleotide ID:ENSMUST00000040284Re-query CCDS DB by Protein ID:ENSMUSP00000040450
Original member Current member EBI ENSMUST00000236421.1 ENSMUSP00000157657.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000236421.1Link to Ensembl Protein Viewer:ENSMUSP00000157657.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000236421Re-query CCDS DB by Protein ID:ENSMUSP00000157657
Original member Current member EBI ENSMUST00000237263.1 ENSMUSP00000158256.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000237263.1Link to Ensembl Protein Viewer:ENSMUSP00000158256.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000237263Re-query CCDS DB by Protein ID:ENSMUSP00000158256
Original member Current member NCBI NM_001001181.4 NP_001001181.1 Accepted alive Link to Nucleotide Sequence:NM_001001181.4Link to Protein Sequence:NP_001001181.1Re-query CCDS DB by Nucleotide ID:NM_001001181Re-query CCDS DB by Protein ID:NP_001001181Link to BLAST:NP_001001181.1
Original member Current member NCBI NM_001358303.1 NP_001345232.1 Accepted alive Link to Nucleotide Sequence:NM_001358303.1Link to Protein Sequence:NP_001345232.1Re-query CCDS DB by Nucleotide ID:NM_001358303Re-query CCDS DB by Protein ID:NP_001345232Link to BLAST:NP_001345232.1
Original member Current member NCBI NM_001358304.1 NP_001345233.1 Accepted alive Link to Nucleotide Sequence:NM_001358304.1Link to Protein Sequence:NP_001345233.1Re-query CCDS DB by Nucleotide ID:NM_001358304Re-query CCDS DB by Protein ID:NP_001345233Link to BLAST:NP_001345233.1
Original member Current member NCBI NM_001358305.1 NP_001345234.1 Accepted alive Link to Nucleotide Sequence:NM_001358305.1Link to Protein Sequence:NP_001345234.1Re-query CCDS DB by Nucleotide ID:NM_001358305Re-query CCDS DB by Protein ID:NP_001345234Link to BLAST:NP_001345234.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001001181.1 72 Q91WE4 72 100% 0 0
NP_001345232.1 72 Q91WE4 72 100% 0 0
NP_001345233.1 72 Q91WE4 72 100% 0 0
NP_001345234.1 72 Q91WE4 72 100% 0 0

Chromosomal Locations for CCDS 37859.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 18 (NC_000084.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18See the combined annotation on chromosome 18 in Sequence Viewer

Chromosome Start Stop Links
18 75008674 75008826 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 75009278 75009343 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (219 nt):
ATGGTGTGCATTCCTTGCATTGTCATTCCAGTCCTGCTCTGGATCTTCAAAAAGTTCCTGGAGCCATACA
TATACCCTGTGGTCAGTCGCATATGGCCTAAAAAAGCCGTCCAGCAATCCGGCGATAAGAATATGAGCAA
GGTAGACTGCAAGGGTGCAGGTACTAATGGATTACCCACAAAAGGACCAACAGAAGTCTCGGATAAAAAG
AAAGACTAG

Translation (72 aa):
MVCIPCIVIPVLLWIFKKFLEPYIYPVVSRIWPKKAVQQSGDKNMSKVDCKGAGTNGLPTKGPTEVSDKK
KD


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH